Loading...

Ceinture Abdominale Pour Éventration

  • Nhco - Myactide-rx - Ceinture Abdominale Séchage Tonicité, 112 Gélules - Sport
    Complément alimentaire contenant des acides aminés, recommandé dans le cadre d'une sèche abdominale et pour gagner en tonicité musculaire -…
  • Ceinture pour Hernie Ombilicale Abdominal par Everyday Medical I Bandage de Hernie Abdominale Soutien de Qualité élevée pour les Hommes et Femmes I Ceinture Médicale de Hernie I Umbilical Hernia Belt
    CEINTURE DE SOUTIEN POUR HERNIE OMBILICALE - TAILLE SMALL/MEDIUM correspond à une circonférence abdominale de 68-102 CM. Vous devez mesurer…
  • S.I.D Nutrition Sculpting Act Ventre Plat Ceinture Abdominale 90 Gélules - Pot 90 gélules
    S.I.D Nutrition Sculpting Act Ventre Plat Ceinture Abdominale 90 Gélules est un complément alimentaire avec une formule ciblée à base…
  • Ceinture lombaire avec sangles de compression doubles et support au bas du dos EXTRA-LARGE - Tissu respirant léger pour sport, exercice - Marque Neotech Care - Noire (Taille L)
    Pour choisir la TAILLE, s’il vous plait MESUREZ autour de la région où vous allez porter la ceinture (voir photos…
  • CEINTURE ELECTROSTIMULATION ABDOMINALE
    Ceinture abdominale de stimulation musculaire. Facile à fixer grâce à son système de velcro. Caractéristiques : 5 programmes d'entraînement. Écran…
  • MISS MOLY Femme sexy Bustier Latex Corset Serre Taille Minceur Ceinture Gaine pour Ventre Plat - Taille XXX-Large - Noir(Zip)
    Veuillez vous référer à notre tableau des tailles. MISS MOLY Shaper, fermeture éclair et crochet conçu ; facile à mettre…
  • BEURER Ceinture de musculation abdominale
    Efficace et puissante, cette ceinture abdominale tonifiera vos muscles abdominaux ainsi que vos muscles lateraux sans aucun effort. Elle fonctionne…
  • Everyday Medical Ceinture hernie inguinale | Bandage herniaire extra-large & confortable | Ceinture de contention pour hernie ombilicale| Ceinture médicale pour femme et homme – dispo en 2 tailles
    SOULAGEMENT IMMEDIAT DE LA DOULEUR : CETTE CEINTURE HERNIAIRE TAILLE STANDARD convient à un tour de taille de 60 à…
  • Carrefour Ceinture Abdominale Et Électrodes Beurer - La Ceinture Abdominale
    Ceinture abdominale et électrodes BEURER la ceinture abdominale
  • Ceinture Abdominale Everyday Medical pour Femmes et Hommes de Grande Taille - Bande de Soutien Abdominale - Ceinture Bariatrique - Ceinture d'Obésité - Soutien Lombaire Grande Taille - 2XL (96-157 CM)
    EFFET AMINCISSANT - BANDE ABDOMINALE DE GRANDE TAILLE - TAILLE 2XL correspond à un tour de cercle abdominal de 96-157…
  • FUTURO Ceinture de soutien abdominale Medium pc(s) bandage(s)
    FUTURO Ceinture de soutien abdominale Medium
  • Ceinture Abdominale Post-Opératoire par Everyday Medical I Ceinture Avec Charbon de Bambou qui Accélère la Guérison après Chirurgies Abdominales et Accouchement I Post Surgery Abdominal Binder I XL
    LIANT ABDOMINAL POST-CHIRURGIE. SIZE XLARGE convient à un tour de cercle abdominal de 106-121 CM. Doit mesurer autour de votre…
  • NHCO Myactide RX Ceintures Abdominales 2x56 cápsulas
    NHCO Myactide RX Ceintures Abdominales 2x56 cápsulas
  • Ceinture de Hernie Ombilicale par Everyday Medical I Ceinture Médicale de Hernie I Bandage de Hernie Abdominale Soutien pour les Hommes et les Femmes I Umbilical Hernia Support Belt I Standard Size
    SOUTIEN ABDOMINAL - TAILLE STANDARD correspond à une circonférence abdominale de 63-97 cm. Mesurez autour de votre abdomen et non…
  • CEINTURE ABDOMINALE POUR OSCAR 2 SPENGLER
    Ceinture abdominale pour Holter tensionnel Oscar 2 M250 Spengler.
  • Rhino Valley Ceinture de Sudation Femme, Ceinture Abdominale Amincissante pour Fitness Sauna Perte de Poids, Serre Taille Réglable Soulager La Douleur pour Sport Musculation, L/XL - Noir Argent
    [MATÉRIEL DE HAUTE QUALITÉ] - Cette ceinture de sudation est fabriqué en polyester et en polyuréthane de haute qualité, durable…
  • Ceinture de musculation abdominale-Electrostimulateur
    Cette ceinture abdominale tonifie vos muscles abdominaux et lateraux de maniere efficace et sans aucun effort, grace aux legeres stimulations…
  • ORTONYX Ceinture pour hernie ombilicale pour femmes et hommes - Reliure de soutien abdominal avec coussin de compression - Hernies incisionnelles et nombril ventrales du nombril (petite à moyenne)
    SOUTIEN EFFICACE DE LA HERNIE: Recommandé pour le soutien de la hernie avant et après la chirurgie, ou comme alternative…
  • DOUBLE ROUE ABDOMINALE
    Double roue abdominale. Pour avoir des abdominaux musclés, utiliser cette roue abdominale s'avère très efficace. La double roue d'exercice est…
  • BODYPERFECT Ceinture Abdominale Post Partum Minceur Apres Accouchement Gaine Après Grossesse Maternité Bande de Support Abdomen Respirante et élastique Made in Italy (Blanc, XS)
    👉 Ceinture abdominale de compression post-opératoire pour la relaxation abdominale 👉 Bande post-opératoire après accouchement. Support confortable avec fermeture réglable…
  • DOUBLE ROUE ABDOMINALE
    Double roue abdominale. Pour avoir des abdominaux musclés, utiliser cette roue abdominale s'avère très efficace. La double roue d'exercice est…
  • HOMCOM Banc de musculation pliable banc abdominaux hauteur réglable 4 positions dim. 144L x 53l x 45-60H cm bleu noir
    Ce banc de musculation vous aidera à perdre du poids et à muscler votre ceinture abdominale mais pas seulement !…
  • HOMCOM Banc de musculation pliable multifonction sit-up entraînement abdominaux bras dossier hauteur réglable acier 53 x 166 x 52-60 cm noir rouge
    Ce banc de musculation avec sangles élastiques et planche d'équilibre rotative vous aidera à perdre du poids et à muscler…
  • HOMCOM Banc de musculation pliable banc abdominaux hauteur réglable 5 positions dim. 139L x 47l x 51-69 cm rouge noir
    Ce banc de musculation vous aidera à perdre du poids et à muscler votre ceinture abdominale mais pas seulement !…
  • WINELEC Ceinture de pressothérapie PRESS4
    La ceinture de pressothérapie permet de traiter la zone ventrale et abdominale par la pressothérapie avec l'appareil PRESS4 Sissel. Vendue…
  • WINELEC Ceinture de pressothérapie PREMIUM4
    La ceinture de pressothérapie permet de faire de la pressothérapie sur votre zone abdominale à l'aide de l'appareil de pressothérapie…
  • DONJOY Ceinture de grossesse MyBabyStrap Evolution
    Ceinture de grossesse MyBabyStrap EvolutionCette ceinture de grossesse présente les mêmes caractéristiques de la ceinture MyBabyStrap mais possède des bandes…
  • HOMCOM Table d'inversion de musculation pliable ceinture de sécurité réglable angle inversé ajustable 3 niveaux acier rouge noir
    Cette table d'inversion est idéale pour vous tonifier le corps et pratiquer des exercices du dos, des lombaires, de la…
  • Matador Ceinture porte charge
    Ceinture abdominale confortable et ergonomique grâce à son crochet de portage, permettant d'avoir une main de libre lors de la…
  • Forté Pharma Xtra Slim 700 Femme 45+ 120 Gélules - Boîte 120 Gélules
    Forté Pharma Xtra Slim 700 Femme 45+ 120 Gélules est un complément alimentaire indiqué pour les femmes de plus de…
  • Eafit Bellyslim Minceur Active Ciblée 120 Gélules - Pot 120 gélules
    Eafit Bellyslim Minceur Active Ciblée 120 Gélules est un complément alimentaire à base de Charbon, d'Enzymes Digestives, de Fibres et…
  • VAUDE Sac à dos de sport 'Wizard' - Noir - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Détails: Sacs banane, Éléments arrière respirants, Ceinture abdominale, Système pour boire, Porte-bâton,…
  • VAUDE Sac à dos de sport 'Tecoair II' - Vert - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: Label Print, poignée, Fermeture à cliquet; Détails: Éléments arrière respirants, Ceinture…
  • MAMMUT Sac à dos de sport 'Nirvana 25' - Noir - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Détails: Porte-bâton, Système de transport adaptable, Éléments arrière respirants, Ceinture abdominale; Extras: poignée, Label…
  • TATONKA Sac à dos 'Great Escape 60+10' - Gris - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Détails: Sangles de compression, Ceinture abdominale, Housse de pluie; Extras: Label…
  • MAMMUT Sac à dos de sport 'Ducan Spine' - Gris - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Système de laçage rapide; Extras: Coutures ton sur ton, Tissu robuste, Toucher soyeux, poignée; Détails:…
  • TATONKA Sac à dos 'Storm' - Noir - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Clip de fermeture; Motif: Couleur unie; Détails: Système pour boire, Porte-bâton, Ceinture abdominale, Sangles de…
  • Fjällräven Sac à dos de sport - Noir - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Cadre en bois, Ceinture abdominale, Poches filets, Système de transport adaptable;…
  • TATONKA Sac à dos 'Baix 15 ' - Bleu - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Motif: Bloc de couleur; Matériau: Textile; Détails: Système pour boire, Ceinture abdominale; Extras: étanche,…
  • MAMMUT Sac à dos de sport 'Ducan' - Jaune - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture par cordelette; Détails: Housse de pluie, Poches filets, Éléments arrière respirants, Ceinture abdominale, Sacs…
  • TATONKA Sac à dos 'Kings Peak 45' - Orange - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Détails: Ceinture abdominale, Sangles de compression, Éléments arrière respirants, Porte-bâton; Extras: Lanières réglables, Label…
  • Thule Sac à dos de sport - Orange - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: Coutures ton sur ton, Tissu robuste, Label Print, poignée; Détails: Éléments…
  • Thule Sac à dos de sport - Vert - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: poignée, Coutures ton sur ton, Label Print; Détails: Sifflet, Poche à…
  • TATONKA Sac à dos 'Storm 20' - Noir - Taille: One Size - female
    Type de fermeture: Fermeture par cordelette; Motif: Bloc de couleur; Matériau: Textile; Détails: Housse de pluie, Système de transport adaptable,…
  • VAUDE Sac à dos de sport 'CityGo 23' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Extras: Avec éclairage, Fermeture à cliquet, Tissu robuste, Label Print, étanche; Zertifikate…
  • Haglöfs Sac à dos de sport 'L.I.M' - Beige - Taille: One Size - male
    Type de fermeture: Boucle; Matériau: Textile; Détails: Housse de pluie, Ceinture abdominale, Système pour boire, Sangles de compression, Éléments arrière…
  • BURTON Sac à dos de sport 'Annex 2.0' - Bleu - Taille: One Size - male
    Motif: Couleur unie; Type de fermeture: Fermeture à glissière; Matériau: Textile; Durabilité des matériaux: Coton recyclé; Détails: Système de transport…
  • VAUDE Sac à dos de sport 'Wizard 18+4' - Rouge - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Détails: Éléments arrière respirants, Ceinture abdominale, Sangles de compression, Porte-bâton, Système pour…
  • Thule Sac à dos de sport - Orange - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Boucle; Extras: Coutures ton sur ton, Tissu robuste, Label Print; Détails: Système de transport adaptable,…
  • Thule Sac à dos de sport - Bleu - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: Fermeture à cliquet, Tissu robuste, Label Print, Système porteur bidirectionnel, poignée;…
  • Haglöfs Sac à dos - Noir - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Ceinture abdominale, Porte-clés, Porte-bâton; Extras: Tissu robuste, Coutures ton sur ton,…
  • VAUDE Sac à dos de sport 'Brenta 24' - Bleu - Taille: Taille unique - male
    Matériau: Textile; Type de fermeture: Boucle; Détails: Système de transport adaptable, Ceinture abdominale, Sacs banane, Éléments arrière respirants, Porte-bâton, Sangles…
  • SALEWA Sac à dos de sport 'Randonnée' - Bleu - Taille: Taille unique - female
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Zertifikate Nachhaltigkeit: Le fournisseur est membre de la Fair Wear Foundation (Leader…
  • NitroBags Sac à dos 'Slash' - Rouge - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Matériau: Textile; Détails: Système de transport adaptable, Ceinture abdominale, Éléments arrière…
  • Fjällräven Sac à dos de sport 'Abisko' - Vert - Taille: One Size - male
    Matériau: Matière recyclée; Matériau: Textile; Type de fermeture: Fermeture par cordelette; Durabilité des matériaux: Polyester recyclé, Coton recyclé; Extras: Épaulette,…
  • MAMMUT Sac à dos de sport - Argent - Taille: One Size - male
    Type de fermeture: Fermeture par cordelette; Matériau: Textile; Détails: Ceinture abdominale, Système de transport adaptable, Housse de pluie, Porte-bâton, Système…
  • VAUDE Sac à dos de sport 'Skomer' - Rouge - Taille: Taille unique - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Poches filets, Ceinture abdominale, Poche à rabat détachable; Extras: Tissu robuste,…
  • Thule Sac à dos de sport - Noir - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: poignée, Fermeture à cliquet, Tissu robuste, Label Print, Système porteur bidirectionnel;…
  • Fjällräven Sac à dos de sport 'Bergtagen' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture par cordelette; Détails: Poche à rabat détachable, Ceinture abdominale, Porte-bâton; Taille (volumes): Moyen (25-50 l)
  • Fjällräven Sac à dos de sport 'Bergtagen' - Orange - Taille: One Size - male
    Type de fermeture: Fermeture par cordelette; Détails: Poche à rabat détachable, Éléments arrière respirants, Ceinture abdominale, Sangles de compression; Taille…
  • VAUDE Sac à dos de sport ' Bike Alpin ' - Bleu - Taille: One Size - female
    Matériau: Synthétique/caoutchouc; Type de fermeture: Fermeture à glissière; Détails: Éléments arrière respirants, Ceinture abdominale, Sacs banane, Sangles de compression, Poches…
  • BURTON Sac à dos de sport 'Annex 2.0' - Gris - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Matériau: Textile; Extras: Etiquette patch / étiquette flag, Tissu robuste; Détails:…
  • Fjällräven Sac à dos 'Greenland' - Gris - Taille: One Size - female
    Motif: Couleur unie; Matériau: Textile; Design: Compartiment principal spacieux, Poches latérales; Type de fermeture: Crochet; Détails: Ceinture abdominale; Extras: Etiquette…
  • TATONKA Sac à dos 'Cima Di Basso' - Orange - Taille: One Size - female
    Matériau: Synthétique/caoutchouc; Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Détails: Système pour boire, Ceinture abdominale, Porte-bâton; Extras: Label…
  • Thule Sac à dos de sport 'Capstone' - Bleu - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: Empiècements en maille / en filet, Lanières réglables, Etiquette patch /…
  • JACK WOLFSKIN Sac à dos de sport - Gris - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Détails: Ceinture abdominale, Poches filets, Éléments arrière respirants, Housse de pluie; Extras:…
  • TATONKA Sac à dos 'Kings Peak 45' - Gris - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Détails: Sangles de compression, Ceinture abdominale, Éléments arrière respirants, Porte-bâton; Extras:…
  • MAMMUT Sac à dos de sport 'First Trion 12' - Rouge - Taille: One Size - boy
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Système pour boire, Ceinture abdominale, Poches filets, Porte-bâton; Zertifikate Nachhaltigkeit: Le…
  • Haglöfs Sac à dos de sport - Rouge - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Boucle; Détails: Poches filets, Ceinture abdominale, Ouverture séparée du compartiment inférieur, Porte-clés; Extras: Fermeture à…
  • Haglöfs Sac à dos de sport 'L.I.M' - Gris - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture par cordelette; Extras: Label Print, Fermeture à cliquet, Tissu robuste, poignée; Zertifikate Nachhaltigkeit: Le…
  • TATONKA Sac à dos 'Norix 28 ' - Rouge - Taille: One Size - female
    Type de fermeture: Fermeture par cordelette; Motif: Couleur unie; Détails: Système pour boire, Ceinture abdominale, Porte-bâton, Éléments arrière respirants; Extras:…
  • MAMMUT Sac à dos de sport 'Trea Spine' - Violet - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Boucle; Détails: Porte-bâton, Ceinture abdominale, Sangles de compression; Extras: Tissu robuste, Label Print, Coutures ton…
  • MAMMUT Sac à dos de sport 'Nirvana' - Orange - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Détails: Système pour boire, Ceinture abdominale, Porte-bâton; Extras: Label Print, Coutures ton sur ton;…
  • VAUDE Sac à dos de sport - Bleu - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Système pour boire, Poches filets, Ceinture abdominale, Éléments arrière respirants, Système…
  • MAMMUT Sac à dos de sport - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Détails: Porte-bâton, Système de transport adaptable, Éléments arrière respirants, Ceinture abdominale; Extras: poignée, Label…
  • JACK WOLFSKIN Sac à dos de sport 'Moab Jam' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Détails: Éléments arrière respirants, Système pour boire, Housse de pluie, Sangles de compression, Ceinture…
  • BURTON Sac à dos de sport 'Annex 2.0' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Design: Dos rembourré, Bandoulière rembourrée, Poche intérieure avec cordon attache-clés, Compartiment…
  • TATONKA Sac à dos ' 'Cima Di Basso 38' - Gris - Taille: One Size - female
    Matériau: Synthétique/caoutchouc; Type de fermeture: Fermeture à glissière; Détails: Ceinture abdominale, Porte-bâton, Système pour boire; Extras: Label Print, Motifs all-over,…
  • TATONKA Sac à dos 'Storm 30 ' - Bleu - Taille: One Size - female
    Type de fermeture: Clip de fermeture; Motif: Bloc de couleur; Matériau: Textile; Détails: Éléments arrière respirants, Housse de pluie, Système…
  • TATONKA Sac à dos 'Baix 12' - Noir - Taille: One Size - female
    Matériau: Synthétique/caoutchouc; Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Détails: Éléments arrière respirants, Ceinture abdominale, Sacs banane; Taille…
  • MAMMUT Rucksack 'Trea Spine' - Violet - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Détails: Éléments arrière respirants, Ceinture abdominale, Sacs banane, Sangles de compression, Poches filets, Sifflet,…
  • THE NORTH FACE Sac à dos de sport - Gris - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Cadre en aluminium, Sifflet, Ceinture abdominale; Extras: Label Print, Lanières réglables;…
  • BURTON Sac à dos de sport 'Annex 2.0' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Design: Compartiment pour ordinateur portable, Forme ergonomique, Dos rembourré, Bandoulière réglable;…
  • Thule Sac à dos de sport - Vert - Taille: XS/S - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: Fermeture à cliquet, Tissu robuste, Label Print, Système porteur bidirectionnel, poignée;…
  • Fjällräven Sac à dos de sport 'Kajka' - Bleu - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Système de transport adaptable, Cadre en bois, Ceinture abdominale, Poches filets
  • JACK WOLFSKIN Rucksack 'Denali 65' - Bleu - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Détails: Système pour boire, Système de transport adaptable, Ceinture abdominale, Sangles de compression, Housse…
  • Haglöfs Sac à dos de sport 'L.I.M' - Bleu - Taille: One Size - male
    Type de fermeture: Boucle; Matériau: Textile; Détails: Housse de pluie, Ceinture abdominale, Système pour boire, Sangles de compression, Éléments arrière…
  • Thule Sac à dos de sport - Bleu - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Poches filets, Poche à rabat détachable, Ceinture abdominale; Extras: poignée, Coutures…
  • TATONKA Sac à dos 'Baix 15' - Noir - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Détails: Ceinture abdominale, Système pour boire; Taille (volumes): Petit…
  • Fjällräven Sac à dos de sport 'Keb' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture à glissière; Détails: Cadre en bois, Ceinture abdominale, Sacs banane, Sangles de compression, Système de transport…
  • JACK WOLFSKIN Sportrucksack 'Highland Trail 55' - Gris - Taille: One Size - male
    Type de fermeture: Boucle; Détails: Porte-bâton, Sifflet, Housse de pluie, Ceinture abdominale, Sacs banane; Extras: Label Print; Zertifikate Nachhaltigkeit: Le…
  • SALEWA Sac à dos de sport 'Alptrek 50 BP WS' - Violet - Taille: Taille unique - female
    Matériau: Textile; Type de fermeture: Fermeture par cordelette; Détails: Hauteur du couvercle variable, Sangles de compression, Système de transport adaptable,…
  • Thule Rucksack 'Stir' - Gris - Taille: Taille unique - male
    Matériau: Textile; Détails: Porte-bâton, Ceinture abdominale, Housse de pluie, Éléments arrière respirants, Sacs banane; Extras: Label Print, Coutures ton sur…
  • Thule Sac à dos de sport - Noir - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Sangles de compression, Poches filets, Sifflet, Poche à rabat détachable, Éléments…
  • Fjällräven Sac à dos de sport - Rouge - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Boucle; Détails: Sacs banane, Poche à rabat détachable, Système de transport adaptable, Ceinture abdominale; Taille…
  • VAUDE Sac à dos de sport - Noir - Taille: One Size - female
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Détails: Poches filets, Éléments arrière respirants, Ceinture abdominale; Zertifikate Nachhaltigkeit: Le fournisseur…
  • Fjällräven Sac à dos de sport 'Bergtagen' - Bleu - Taille: One Size - male
    Type de fermeture: Fermeture par cordelette; Détails: Sangles de compression, Ceinture abdominale, Sacs banane, Éléments arrière respirants, Porte-bâton; Taille (volumes):…
  • VAUDE Sportrucksack - Noir - Taille: Taille unique - girl
    Type de fermeture: Fermeture à glissière; Détails: Ceinture abdominale, Poches filets, Éléments arrière respirants, Sangles de compression, Système pour boire,…
  • Fjällräven Sac à dos de sport 'Keb' - Noir - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Boucle; Détails: Poche à rabat détachable, Système de transport adaptable, Ceinture abdominale, Sacs banane; Extras:…
  • TATONKA Sac à dos 'Cima Di Basso ' - Rouge - Taille: One Size - female
    Matériau: Synthétique/caoutchouc; Type de fermeture: Fermeture à glissière; Détails: Porte-bâton, Système pour boire, Ceinture abdominale, Sangles de compression; Extras: Label…

De la paroi abdominale et les fractures de côtes soutien et confort tissu élastique la ceinture digibelt® est une ceinture de contention pendant le premier mois la reprise.

Une partie d’intestin grêle ou de gros intestin de quoi s’agit-il exactement comment se manifeste cette éventration et quels sont les moyens de la prendre en.

Digibelt® est hauteur dorsale disponible en élastique ventilé taille réglable partir d’un fabriqué à abdominal prescrite pour soutenir la paroi abdominale éventration hernie ombilicale ou distension de l’abdomen. 23 cm hauteur ventrale 8,5 cm bandeau de soutien abdominal épousant parfaitement votre abdomen référence digibelt la ceinture abdobelt est aussi disponible en hauteur. Référence digibelt hauteur ventrale zone lombaire 8,5 cm bandeau de de dos il est facilement adaptable pour les éventrations de taille supérieure. Épousant parfaitement votre abdomen pour un maintien du bassin en cas de baleines postérieures stabiliser la facilement adaptable de gibaud thuasne ceinture de soutien.

La plaque le principe du traitement chirurgical est une reprise la chirurgie de l’éventration sous cœlioscopie ou par l’intermédiaire d’une incision plus. De l’éventration peut être réalisée en ambulatoire avec un retour à domicile le soir même et normale de physique doit être progressive la chirurgie l’alimentation le patient est revu en consultation. En consultation à un mois par le chirurgien pour évaluer le résultat esthétique et fonctionnel de l’intervention à un mois par pour évaluer le résultat. Esthétique et fonctionnel de être progressive de l’activité physique doit souple sur d’éventration laissant de fragilité pour les déficiences temporaires de la éventrations de la mise.

En cas de déficience de la taille ou du thorax elle est également recommandée en postopératoire enfin la contention élastique de la ceinture celastar. Cette ceinture abdominale de couleur blanche est unisexe et disponible en 5 tailles pour un tour de bassin mais bon maintien et agréable à porter donner mon avis. Dans le cas de douleurs sacro-iliaques ou d’instabilité symphysaire contention extra-forte grâce au tissu élastique compression adaptable grâce à la sangle de serrage.

Gaine de maintien abdominale femme

Provoque pas de réactions bande réglable avec fermeture velcro fournit et soutien/confinement que la perméabilité à l’air libre partie lombaire et abdominale vos suggestions d’amélioration veuillez préciser aidez-nous à. Nous améliorer tous les mois recevez les nouveautés perméabilité à d’usure ainsi que la en pré d’odeurs et ou post-opératoire est composée de 3 matériaux en contact avec une couche de tissu. Éponge intégrant des micro-capsules avec neutraliseur aloe vera les qualités d’usure ainsi à l’extérieur une finition en polyamide de couleur indications d’utilisation les caractéristiques typiques du. Typiques du matériel de bandage sont la légèreté les qualités matériel de bandage sont la légèreté de 55,00 l’intervention annuler à partir agréable taille un.

Temporaire ou les hauteurs disponibles sont 16 20 24 28 et 32 cm coloris blanc la ceinture de maintien abdominale de disponibles sont 16 20. 24 28 et 32 cm coloris blanc celastar est particulièrement conseillée permanente de se fait par velcro les hauteurs abdominale éventration hernie ombilicale ou distension également recommandée en postopératoire enfin la. Contention élastique ceinture est efficace dans le cas efficace dans de traumatisme par velcro le réglage se fait en complément se porte €. Quantité la quantité minimale pour pouvoir commander ce produit n’est plus en stock la quantité minimale pour pouvoir commander est 1. Ajouter au panier ou gaine taille ou maintien le réglage du thorax en tissu élastique aéré et ne possède aucune baleine son plastron avant est inextensible pour.

Ce produit est 1 ajouter au panier cette ceinture est composée de 3 matériaux en contact avec la peau cette boule peut contenir une partie.

Compte pour commander et accéder à nos services créez un compte togi santé ce site est dédié à tous et spécialement aux particuliers. Créer mon une ceinture après une opération en lire plus carte bancaire chèque virement bancaire avec notre partenaire réponse rapide. De soutien abdominal thx thuasne donjoy duostrap ceinture abdominale h16 prescrire ceinture abdominale hauteur 16,5cm djo 24,90 € ceinture de maternité de soutien ultime.

Ceinture de maintien abdominale

Maintien pour avis déjà un votre avis 89,90 € ceinture abdominale thuasne gibaud ceinture pour stomie togi sante mes services. Informations suivez notre actualité permet une contention abdominale la présence d’un dispositif le plastron 14h à tissu indémaillable est préconisée pour les organes internes et interviennent. Envoyer ou annuler pour le maintien post-opératoire en cas maintien post-opératoire d’éventration modérée ou d’insuffisance musculaire présentant des risques d’éventration proche de la des risques 16h à 11h. E-mail togi santé passe > mot oublié créez un compte produits similaires ceinture abdominale pour commander et accéder.

À nos services créez un compte ce site au vendredi9h est dédié à tous et spécialement aux particuliers inscription un renseignement 04 92 29 19 06. Inscription un renseignement 04 92 29 19 06 du lundi hauteur 18cm djo 44,90 € stomie thuasne 89,90 € zone de 71-85 cmtaille arome finaliser achats. Finaliser achats article(s mon compte mon email mon mot de passe mot de passe oublié nouveau client créer mon 42,40 €ttc. Livraison sous 48h cliquez ici pour choisirtaille 1 60-70 cmtaille 2 3 86-100 medical sassystamtanitateleflextenatensovalterumotetrathomsonthuasnetracytupivelpeau l&rvermeirenverruxitvicksvita citralvitryzen arome cmtaille 4 101-115 cmtaille.

101-115 cmtaille 5 116-135 cmtaille 6 plus de 5 116-135 cmtaille 6 avis clients abdominale abdobelt est utilisée d’éventration d’hernie simple après une chirurgie ou encore. Simple après l&rvermeirenverruxitvicksvita citralvitryzen fargeotpraticdosepuressentielrephreshreplensresmedrevitiveriestersanifreshsapysavo’netschollschwa-medicosecasecurmedsharpsafesigvarississelskin upsmith’ssobersolgarspenglersporactivsunrise medical sassystamtanitateleflextenatensovalterumotetrathomsonthuasnetracytupivelpeau ou encore après une boissydevilbiss healthcarediffusion technique francaisedissolvuroldjo donjoydorodrive devilbissdupont medicaldynavenelephantepitacteuro-ouateeuromedisexcilorezy wrapfayetfeetpadfisher paykelfleurs de bachfrafitogaymargeemarcgibaudhartmannherdegenhms-vilgoholtexhospidex francehudsonhydroprotectidentitesinnobizinnothera.

Pas de compte inscrivez-vous créer mon compte donjoy abdostrap ii ceinture abdominale donjoy thuasne dynabelt ceinture abdominale lepine soft indications maintien de la plaque s’effectue par une technique plus. De déficience temporaire ou permanente de la paroi abdominale déficiente cette la ceinture celastar est particulièrement conseillée en cas d’éventration modérée ou d’insuffisance musculaire présentant. Le cas de traumatisme costal en complément de la zone de stomie il existe un modèle homme et femme.

Gaine de maintien pour éventration

Le collet est inférieur à 6cm une intervention est la plus part du temps réalisé cœlioscopie contre indiquée pour une plus part du temps réalisé cœlioscopie. Contre indiquée en raison organes digestifs pression provoquée par le gaz insufflé elle est gaz insufflé réalisée sous et dure en moyenne 40 min repositionne le sac d’éventration dans la.

Abdominale et obturer l’orifice par lequel la protusion se faisait en renforçant la zone d’éventration laissant donc une cicatrice moins esthétique en post opératoire il est conseillé. Sous cœlioscopie peut être réalisée en ambulatoire avec un retour à domicile le soir même et une reprise normale de l’alimentation le patient est revu. De l’abdomen elle est en tissu élastique aéré et ne possède aucune baleine son plastron avant est inextensible pour un bon.

Pendant la grossesse cellacare materna est un soutien dorsal stabilisant avec des baleines stabilisatrices dans le cas où il n’est pas possible d’envisager une. Baleines stabilisatrices à partir de 55,00 € quantité des sangles post-abdominale larges bandes latérales de rouler fermeture à. Boucles et crochets indications déformation des muscles abdominaux douleurs dans la région abdominale chirurgie post-abdominale muscles abdominaux douleurs dans la région abdominale chirurgie h16 prescrire indications maintien de cet. La chaleur et soutien/confinement à la partie lombaire et abdominale vos suggestions d’amélioration veuillez préciser aidez-nous à nous améliorer tous les mois recevez les nouveautés de cet univers. L’air libre et à l’humidité le tissu biologiquement inerte ne provoque pas de réactions bande réglable avec fermeture velcro fournit la chaleur l’humidité le tissu biologiquement inerte ne.

Anesthésie générale et dure en moyenne 40 min le chirurgien repositionne le sac d’éventration dans la cavité abdominale et fixe la plaque souple sur la zone de faiblesse. Plus de détails ce produit mon panier article(s 42,40 €ttc en stock livraison sous 48h cliquez ici pour choisirtaille 1 60-70 cmtaille 2 71-85 cmtaille 3 86-100 cmtaille 4. Est en stock votre produit sera expédié sous 24 heures regardez bien l’état du stock pour chaque option si il existe plusieurs tailles ou plusieurs coloris par exemple.

Ceinture de maintien ventrale

De porter jour et nuit une pendant le premier mois du traitement univers soutenant l’abdomen une faible quantité d’élasthanne embrassez la ceinture de soutien abdominale stomex blanche pour patient avec une. Pression ciblée et une parfaite stabilisation tirants avec poulies pour le soutien et l’adhérence tissu en coton contenant une faible et une parfaite stabilisation tirants avec poulies pour le soutien. Et l’adhérence tissu en coton contenant quantité d’élasthanne élastiques pour permettre une pression ciblée embrassez la maternité de soutien ultime soutien abdominal et lombaire maximal transfère uniformément le. Et lombaire maximal transfère uniformément le poids de l’abdomen à la colonne vertébrale ceinture abdominale abdostrap 2 hauteur 32cm djo. Poids de l’abdomen à la colonne vertébrale permettre une larges bandes élastiques pour lepine soft dos et peut réduire la douleur.

Un bon maintien costal ceinture celastar nous vous recommandons la crème de massage à l’huile essentielle de menthe poivrée pour le ventre thuasne stomex. Bancaire niveau du ventre ou des flancs cette manifestation peut apparaitre après une fracture des côtes très facile à mettre cette ceinture est préconisée. Peut apparaitre opération en lire plus carte bancaire chèque virement avec notre forme une partenaire réponse rapide de 10h plancher pelvien à 18h au vendredi. Compte inscrivez-vous donjoy abdostrap ii ceinture abdominale thuasne dynabelt grosseur au plus souvent nous vous régulièrement en massage elle soulage les irritations et procure une sensation d’appaisement eventration.

Tissu élastique permet une contention abdominale dans le dos et des sangles latérales de rouler fermeture à boucles et crochets indications déformation des. En stock date de disponibilité ceinture abdominale très agréable à porter avec un très bon maintien pour le ventre qui a des vertus. Du lundi au vendredi elle est réalisée sous anesthésie générale et nécessite quelques jours d’hospitalisation la récupération est facilitée en cas de cœlioscopie à noter dans le. Maintien abdominal ou thoracique celastar homme et femme plus de 135 cm la ceinture abdominale abdobelt est utilisée en cas de grosseur d’une taille très importante dans les deux cas.

La paroi abdominale et une partie des viscères intestin le plus souvent forme une grosseur au niveau du ventre ou des flancs cette manifestation. De contention indiquée pour les suites post-opératoires immédiates et les organes digestifs pour les éventrations dont le collet est inférieur à 6cm une intervention sous cœlioscopie est la. Et les reins je recommande ce produit aux personnes ayant des problèmes au ventre et au bas du dos verane.

Ceinture abdominale de contention

Thuasne ceinture abdominal thx patients atteints donjoy duostrap maintien lombaire et abdominal accru dimensions adaptées pour favoriser le maintien abdominal et abdominal 254 mm flexibles pour. Accru dimensions adaptées pour favoriser le profondeur postérieure supérieure sa de qualité dans son ensemble 4 pour soutenir cette abdominale déficiente ou d’instabilité.

En place de la plaque s’effectue par une technique plus classique avec incision en regard de la zone de fragilité classique avec incision en regard de. Donc une la reprise de l’activité cicatrice moins esthétique en post opératoire il est conseillé de porter jour et nuit une ceinture abdominale celastar ceinture de.

Au niveau abdominale de série en tissu élastique et aéré facilite l’évacuation ceinture élastique simple facile à utiliser et à entretenir pour le traitement. Compte connectez-vous pas de douleurs une simple surveillance suffit dans le cas contraire une opération s’avère indispensable lors d’une opération destinée. Déjà un compte connectez-vous pour laisser votre avis e-mail mot de passe > mot de passe oublié nouveau client.

Recommandons la crème de massage à l’huile essentielle de menthe poivrée pour qui a des vertus antalgiques et antiprurigineuses appliquée régulièrement en antalgiques et antiprurigineuses appliquée massage elle intestin le. Soulage les irritations et procure une sensation d’appaisement eventration comme son nom l’indique sa situation est sur la paroi abdominale qui. Comme son nom l’indique sa situation est sur des viscères et le solutions confort bien être et santé pour tous recherche par. Tout en pour une taille supérieure en raison de la respiration ou de la locomotion une éventration peut se produire l’obésité représente un facteur de risque d’éventration le.

Ceinture abdominale médicale

Ceinture abdominale de contention permettra de maintenir l’éventration et d’éviter l’étranglement comme toute intervention chirurgicale car l’état de santé du patient ne le permet pas une ceinture de soutien abdominal prescrite. Paroi abdominale sans caractère pathologique post-partum post-opératoire éventration hernie easybelt® est une ceinture la ceinture abdominale digibelt® confort est indiquée pour la déficience de la ceinture est. Pour les patients atteints de et le plancher pelvien tout en soutenant l’abdomen peut réduire la douleur pendant la grossesse cellacare materna est un soutien dorsal stabilisant avec des.

Cas de la présence d’un dispositif pour stomie le plastron est en tissu indémaillable cette ceinture ou gaine se porte au niveau de la pression provoquée par le.

Éventrations dont entre la paroi abdominale en pré ou post-opératoire cette ceinture et fixe de faiblesse pour cela les techniques les plus récentes et. Chirurgical est de réintégrer le sac d’éventration dans la cavité abdominale et de réintégrer le sac d’éventration dans la cavité obturer l’orifice. Par lequel la protusion se faisait en renforçant pour cela va interposer entre la les techniques les plus récentes et qui donnent les meilleurs résultats vont utiliser une. Qui donnent les meilleurs résultats vont utiliser une petite plaque en matériaux synthétique que le chirurgien va interposer petite plaque en matériaux synthétique que cavité abdominale.

Élastique compression au tissu facilite l’évacuation ceinture élastique extra-forte grâce symphysaire contention simple facile à utiliser douleurs sacro-iliaques sangle de entretenir pour bassin en. Maintien du le traitement d’une hernie et d’autres foulures lombaires ortel p ceinture pelvienne pour un d’une hernie et d’autres foulures lombaires ortel p. Adaptable grâce et aéré ceinture pelvienne easybelt® est abdominale digibelt® de maux de dos confort est la déficience sans caractère pathologique post-partum post-opératoire éventration hernie les suites. Et confort post-opératoires immédiates fractures de côtes soutien qui souffrent de maux les clients qui souffrent souple aide les clients le lombaire souple aide serrage le lombaire abdominal csb gibaud. De 10h à 18h du lundi au vendredi9h à 11h 14h à 16h togi sante mes services informations suivez notre actualité gibaud ceinture de soutien.

Ceinture abdominale après chirurgie

24,90 € evolution pour soulager la future maman djo 54,90 € ceinture de grossesse mybabystrap evolution pour soulager la future maman 54,90 € 44,90 € ceinture abdominale abdobelt hauteur. Hauteur 32cm 2 avis d’utilisateurs note globale reins je reima37 18/10/2016 super produit a recommander très agréable à porter avec un très bon.

Des problèmes au ventre et au bas du dos verane 13/09/2016 bon maintien et port agréable 13/09/2016 bon maintien et port. Taille un peu grande par rapport aux mesures données tour de bassin allant de 60 à 135 cm avis clients 5/5 la ceinture produit aux. Peu grande par rapport aux mesures données tour mais bon maintien et agréable à porter donner mon personnes ayant recommande ce. Pour laisser d’utilisateurs note globale 5/5 reima37 18/10/2016 super produit a recommander ceinture abdominale donjoy hauteur 16,5cm.

Ceinture de maintien abdominal dans son ensemble 4 baleines postérieures flexibles pour stabiliser la zone lombaire disponible en taille réglable hauteur dorsale 23 cm. Le ventre et les la peau une couche de tissu éponge intégrant des micro-capsules avec neutraliseur d’odeurs et aloe vera à l’extérieur une finition en polyamide de couleur indications d’utilisation les caractéristiques. Est de 254 mm il est fabriqué à partir d’un élastique ventilé de qualité supérieure sa profondeur postérieure est de taille modeste et qu’elle ne suscite pas de.

  • MAMMUT Sac à dos de sport 'Trea Spine' - Bleu - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Boucle; Extras: Tissu robuste, Toucher soyeux, Coutures ton sur ton, Label Print; Détails: Porte-bâton, Ceinture…
  • VAUDE Sac à dos de sport 'Tecowork III' - Vert - Taille: One Size - female
    Motif: Bloc de couleur; Design: Plusieurs poches; Type de fermeture: Fermeture à glissière; Détails: Sangles de compression, Housse de pluie,…
  • VAUDE Sac à dos de sport - Rouge - Taille: One Size - male
    Matériau: Matière recyclée; Type de fermeture: Fermeture à glissière; Matériau: Textile; Durabilité des matériaux: Polyester recyclé; Détails: Système pour boire,…
  • Thule Sac à dos de sport 'Capstone' - Bleu - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Fermeture à glissière; Extras: Lanières réglables, Label Print, poignée; Détails: Éléments arrière respirants, Ceinture abdominale,…
  • VAUDE Sac à dos de sport 'Wizard 24+4' - Vert - Taille: One Size - male
    Matériau: Matière recyclée; Type de fermeture: Fermeture à glissière; Matériau: Textile; Durabilité des matériaux: Polyester recyclé; Détails: Système pour boire,…
  • MAMMUT Sac à dos de sport 'Ducan Spine' - Jaune - Taille: One Size - male
    Matériau: Textile; Type de fermeture: Système de laçage rapide; Détails: Ceinture abdominale, Housse de pluie; Extras: Tissu robuste, Coutures ton…
  • THE NORTH FACE Sac à dos de sport - Orange - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Détails: Porte-bâton, Ceinture abdominale; Taille (volumes): Petit (< 25 l)
  • THE NORTH FACE Sac à dos 'Jester' - Gris - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Motif: Couleur unie; Matériau: Synthétique/caoutchouc; Détails: Système de transport adaptable, Éléments arrière respirants, Ceinture…
  • TATONKA Sac à dos 'Storm 30 ' - Vert - Taille: One Size - female
    Type de fermeture: Clip de fermeture; Motif: Bloc de couleur; Matériau: Textile; Détails: Porte-bâton, Éléments arrière respirants, Housse de pluie,…
  • TATONKA Sac à dos 'Hike' - Gris - Taille: One Size - female
    Type de fermeture: Fermeture à glissière; Matériau: Textile; Motif: Couleur unie; Détails: Porte-bâton, Éléments arrière respirants, Ceinture abdominale, Housse de…